Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial (Active)

Artikelnummer: BYT-ORB1785090
Artikelname: Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial (Active)
Artikelnummer: BYT-ORB1785090
Hersteller Artikelnummer: orb1785090
Alternativnummer: BYT-ORB1785090-20,BYT-ORB1785090-100,BYT-ORB1785090-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Gastric inhibitory polypeptide receptor,GIP-R,Glucose-dependent insulinotropic polypeptide receptor,Gipr
This Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial (Active) spans the amino acid sequence from region 19-134aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 14.7 kDa
UniProt: Q0P543
Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Gipr at 2 µg/mL can bind Anti-Mouse Gipr Recombinant Antibody, the EC50 is 8.622-11.36 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Mouse Gipr at 2µg/mL can bind Anti-Mouse Gipr recombinant antibody, the EC50 is 8.622-11.36 ng/mL.