Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial

Artikelnummer: BYT-ORB1785279
Artikelname: Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial
Artikelnummer: BYT-ORB1785279
Hersteller Artikelnummer: orb1785279
Alternativnummer: BYT-ORB1785279-1,BYT-ORB1785279-100,BYT-ORB1785279-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: (Protein Ly6-D)(Megakaryocyte-enhanced gene transcript 1 protein)
This Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial spans the amino acid sequence from region 20-104aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 38.0 kDa
UniProt: O95868
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of Ly6g6d was greater than 95% as determined by SEC-HPLC