Recombinant Macaca fascicularis Cadherin 17 (CDH17), partial (Active)

Produktübersicht

• Artikelname: Recombinant Macaca fascicularis Cadherin 17 (CDH17), partial (Active)
• Artikelnummer: BYT-ORB1785280
• Hersteller Artikelnummer: orb1785280
• Alternativnummer: BYT-ORB1785280-1,BYT-ORB1785280-100,BYT-ORB1785280-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cadherin-17, Liver-intestine cadherin, CDH17

Produktbeschreibung

This Recombinant Macaca fascicularis Cadherin 17 (CDH17), partial (Active) spans the amino acid sequence from region 30-792aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 86.4 kDa
• UniProt: A0A2K5X8I8
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: KILSEIGDLLQIPQLCFFPYSLICCFFPQFKANPPAVTFELTGETDNIFKIEQEGLLYYTKALDRETRSTHNLQVAALDANGAIVEGPVPITIEVKDVNDNRPTFLQSKYEGSVRQNSRPGKPFLYVNATDLDDPATPNGQLSYQIVIQLPMINNVMYFQINNKTGGISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWKAPEPVEMVENSTDPHPIKITQVRWNDPGAQYSLVDK

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CDH17 at 2 µg/mL can bind Anti-CDH17 recombinant antibody. The EC50 is 2.182-2.529 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CDH17 at 2µg/mL can bind Anti-CDH17 antibody, the EC50 is 4.666-5.447 ng/mL