Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial

Produktübersicht

• Artikelname: Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial
• Artikelnummer: BYT-ORB1785310
• Hersteller Artikelnummer: orb1785310
• Alternativnummer: BYT-ORB1785310-1,BYT-ORB1785310-100,BYT-ORB1785310-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: (IL-15 receptor subunit alpha)(IL-15R-alpha)(IL-15RA)(CD antigen CD215)(sIL-15 receptor subunit alpha)(sIL-15R-alpha)(sIL-15RA)

Produktbeschreibung

This Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial spans the amino acid sequence from region 31-205aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 47.3 kDa
• UniProt: Q13261
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The purity of IL15RA was greater than 90% as determined by SEC-HPLC