Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7) (Active)

Artikelnummer: BYT-ORB1785331
Artikelname: Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7) (Active)
Artikelnummer: BYT-ORB1785331
Hersteller Artikelnummer: orb1785331
Alternativnummer: BYT-ORB1785331-1,BYT-ORB1785331-100,BYT-ORB1785331-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Insulin-like growth factor-binding protein 7, IBP-7, IGF-binding protein 7,IGFBP-7, IGFBP-rP1, MAC25 protein, PGI2-stimulating factor, Prostacyclin-stimulating factor, Tumor-derived adhesion factor (TAF), IGFBP7,MAC25, PSF
This Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7) spans the amino acid sequence from region 27-282aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 55.4 kDa
UniProt: Q16270
Puffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 µg/mL can bind Human IGFBP7. The EC50 is 3.405-5.456 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 µg/ml can bind Human IGFBP7. The EC50 is 3.405-5.456 ng/mL.