Recombinant Human Claudin-6 (CLDN6), Fluorescent-VLPs (Active)

Produktübersicht

• Artikelname: Recombinant Human Claudin-6 (CLDN6), Fluorescent-VLPs (Active)
• Artikelnummer: BYT-ORB1785364
• Hersteller Artikelnummer: orb1785364
• Alternativnummer: BYT-ORB1785364-1,BYT-ORB1785364-100,BYT-ORB1785364-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: UNQ757,PRO1488

Produktbeschreibung

This Recombinant Human Claudin-6 (CLDN6)-VLPs, Fluorescent (Active) spans the sequence from region 1-220aa.

Produkteigenschaften

• Molekulargewicht: 50.5 kDa
• UniProt: P56747
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Quelle: Homo sapiens (Human)
• Formulierung: Lyophilized powder
• Sequenz: MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 µg/mL can bind Anti-CLDN6/9 recombinant antibody, the EC50 is 0.5574-0.7361 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing

Bilder

Detected by Mouse anti-GFP monoclonal antibody. The two bands respectively correspond to monomer, Homodimer.

Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 µg/mL can bind Anti-CLDN6/9 recombinant antibody, the EC50 is 0.5574-0.7361 ng/mL.

The presence of VLP-like structures was confirmed by TEM.