Recombinant Human Myosin regulatory light chain 12A (MYL12A) (Active)

Produktübersicht

• Artikelname: Recombinant Human Myosin regulatory light chain 12A (MYL12A) (Active)
• Artikelnummer: BYT-ORB1785410
• Hersteller Artikelnummer: orb1785410
• Alternativnummer: BYT-ORB1785410-1,BYT-ORB1785410-100,BYT-ORB1785410-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: MLCB,MRLC3,RLC

Produktbeschreibung

This Recombinant Human Myosin regulatory light chain 12A (MYL12A) (Active) spans the amino acid sequence from region 1-171aa. Purity: Greater than 95% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 26.7 kDa
• UniProt: P19105
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human MYL12A at 2 µg/mL can bind Anti-MYL9 recombinant antibody. The EC50 is 5.325-6.456 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human MYL12A at 2µg/mL can bind Anti-MYL9 recombinant antibody, the EC50 is 5.325-6.456 ng/mL.