Recombinant Human Proprotein convertase subtilisin/kexin type 9 (PCSK9) (D374Y), Biotinylated (Active)

Artikelnummer: BYT-ORB1881659
Artikelname: Recombinant Human Proprotein convertase subtilisin/kexin type 9 (PCSK9) (D374Y), Biotinylated (Active)
Artikelnummer: BYT-ORB1881659
Hersteller Artikelnummer: orb1881659
Alternativnummer: BYT-ORB1881659-1,BYT-ORB1881659-100,BYT-ORB1881659-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Proprotein convertase subtilisin/kexin type 9, EC:3.4.21.-, Neural apoptosis-regulated convertase 1 (NARC-1), Proprotein convertase 9 (PC9), Subtilisin/kexin-like protease PC9, PCSK9, NARC1, PSEC0052
This Recombinant Human Proprotein convertase subtilisin/kexin type 9 (PCSK9) (D374Y), partial, Biotinylated spans the amino acid sequence from region 31-692aa(D374Y). Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 76.0 kDa
UniProt: Q8NBP7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVV
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Anti-PCSK9 recombinant antibody at 2 µg/mL can bind Human PCSK9 protein. The EC50 is 7.450-8.692 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human PCSK9 at 2 µg/mL on streptavidin coated plates can bind Anti-PCSK9 recombinant antibody. The EC50 is 0.3792-1.157 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of PCSK9 was greater than 95% as determined by SEC-HPLC