Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A) (F176V), partial (Active)

Artikelnummer: BYT-ORB1881660
Artikelname: Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A) (F176V), partial (Active)
Artikelnummer: BYT-ORB1881660
Hersteller Artikelnummer: orb1881660
Alternativnummer: BYT-ORB1881660-1,BYT-ORB1881660-100,BYT-ORB1881660-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: CD16A
This Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A)(F176V), partial (Active) spans the amino acid sequence from region 17-208aa(F176V). Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 90.6 kDa
UniProt: P08637
Puffer: Lyophilized from a 0.2 µm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Loaded Anti-Human CD16a Antibody on 96-Flat plate, can bind Human CD16a (F176V), with an affinity constant of 12 nM as determined in BLI assay (Gator Prime). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Loaded Anti-Human CD16a Antibody on 96-Flat plate, can bind Human CD16a (F176V), with an affinity constant of 12 nM as determined in BLI assay (Gator Prime).