Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1)-VLPs

Produktübersicht

• Artikelname: Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1)-VLPs
• Artikelnummer: BYT-ORB1881814
• Hersteller Artikelnummer: orb1881814
• Alternativnummer: BYT-ORB1881814-20,BYT-ORB1881814-100,BYT-ORB1881814-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: B-cell differentiation antigen Ly-44,Lymphocyte antigen 44,Membrane-spanning 4-domains subfamily A member 1,CD antigen CD20

Produktbeschreibung

This Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1)-VLPs spans the amino acid sequence from region 1-291aa. Purity: The purity information is not available for VLPs proteins.

Produkteigenschaften

• Molekulargewicht: 33.7 kDa
• UniProt: P19437
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Quelle: Mus musculus (Mouse)
• Reinheit: The purity information is not available for VLPs proteins.
• Formulierung: Lyophilized powder
• Sequenz: MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing

Bilder

Detected by Mouse anti-6*His monoclonal antibody.

The purity of VLPs was greater than 95% as determined by SEC-HPLC