Recombinant Human Thymic stromal lymphopoietin (TSLP) (R127A,R130A)

Produktübersicht

• Artikelname: Recombinant Human Thymic stromal lymphopoietin (TSLP) (R127A,R130A)
• Artikelnummer: BYT-ORB1881826
• Hersteller Artikelnummer: orb1881826
• Alternativnummer: BYT-ORB1881826-20,BYT-ORB1881826-100,BYT-ORB1881826-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide

Produktbeschreibung

This Recombinant Human Thymic stromal lymphopoietin (TSLP) (R127A,R130A) spans the amino acid sequence from region 29-159aa(R127A,R130A). Purity: Greater than 95% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 44.1 kDa
• UniProt: Q969D9
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The purity of TSLP was greater than 95% as determined by SEC-HPLC