Recombinant Human Interleukin-6 (IL6) Protein (Active)

Produktübersicht

• Artikelname: Recombinant Human Interleukin-6 (IL6) Protein (Active)
• Artikelnummer: BYT-ORB1881858
• Hersteller Artikelnummer: orb1881858
• Alternativnummer: BYT-ORB1881858-20,BYT-ORB1881858-100,BYT-ORB1881858-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Interleukin-6, IL-6, B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2), IL6 , IFNB2

Produktbeschreibung

This Recombinant Human Interleukin-6 (IL6) Protein (Active) spans the amino acid sequence from region 30-212aa. Purity: Greater than 95% as determined by SDS-PAGE

Produkteigenschaften

• Molekulargewicht: 22.8 kDa
• UniProt: P05231
• Puffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 95% as determined by SDS-PAGE
• Formulierung: Lyophilized powder
• Sequenz: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 58 - 295 pg/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

orb1881858

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 58 - 295 pg/mL.