Recombinant Human Serine/threonine-protein kinase receptor R3 (ACVRL1), partial (Active)

Artikelnummer: BYT-ORB1882059
Artikelname: Recombinant Human Serine/threonine-protein kinase receptor R3 (ACVRL1), partial (Active)
Artikelnummer: BYT-ORB1882059
Hersteller Artikelnummer: orb1882059
Alternativnummer: BYT-ORB1882059-20,BYT-ORB1882059-100,BYT-ORB1882059-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ACVRLK1,ALK1,
This Recombinant Human Serine/threonine-protein kinase receptor R3 (ACVRL1), partial (Active) spans the amino acid sequence from region 22-118aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 11.5 kDa
UniProt: P37023
Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human ACVRL1 at 2 µg/mL can bind Anti-ACVRL1 recombinant antibody, the EC50 is 2.417-2.971 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human ACVRL1 at 2µg/mL can bind Anti-ACVRL1 recombinant antibody, the EC50 is 2.417-2.971 ng/mL.