SMU1 Peptide - N-terminal region

Produktübersicht

• Artikelname: SMU1 Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004106
• Hersteller Artikelnummer: orb2004106
• Alternativnummer: BYT-ORB2004106-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: BWD, RP11-54K16.3, SMU-1, fSAP57

Produktbeschreibung

SMU1 Peptide - N-terminal region

Produkteigenschaften

• NCBI: 060695
• UniProt: Q2TAY7
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: TDPMIMLKQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQAL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with SMU1 Rabbit Polyclonal Antibody (orb583470). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings