MED6 Peptide - C-terminal region

Produktübersicht

• Artikelname: MED6 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004140
• Hersteller Artikelnummer: orb2004140
• Alternativnummer: BYT-ORB2004140-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: IHC, WB
• Alternative Synonym: NY-REN-28

Produktbeschreibung

MED6 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 005457
• UniProt: O75586
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: KPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNVQQTVSAKGPPEKRMRL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with MED6 Rabbit Polyclonal Antibody (orb576768). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings