OR13J1 Peptide - C-terminal region

Produktübersicht

• Artikelname: OR13J1 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004169
• Hersteller Artikelnummer: orb2004169
• Alternativnummer: BYT-ORB2004169-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: OR9-2

Produktbeschreibung

OR13J1 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 001004487
• UniProt: Q8NGT2
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: ILRVPSAARCCKAFSTCLAHLAVVLLFYGTIIFMYLKPKSKEAHISDEVF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with OR13J1 Rabbit Polyclonal Antibody (orb587681). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings