OR5D14 Peptide - C-terminal region

Artikelnummer: BYT-ORB2004172
Artikelname: OR5D14 Peptide - C-terminal region
Artikelnummer: BYT-ORB2004172
Hersteller Artikelnummer: orb2004172
Alternativnummer: BYT-ORB2004172-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: OR11-141, OR11-150
OR5D14 Peptide - C-terminal region
NCBI: 001004735
UniProt: Q8NGL3
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: TILFLYCVPNSKNSRQTVKVASVFYTVVNPMLNPLIYSLRNKDVKDAFWK
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with OR5D14 Rabbit Polyclonal Antibody (orb587614). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings