OR5D13 Peptide - C-terminal region

Produktübersicht

• Artikelname: OR5D13 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004173
• Hersteller Artikelnummer: orb2004173
• Alternativnummer: BYT-ORB2004173-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB

Produktbeschreibung

OR5D13 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 001001967
• UniProt: Q8NGL4
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: YCVPNPKTSSLIVTVASVFYTVAIPMLNPLIYSLRNKDINNMFEKLVVTK

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with OR5D13 Rabbit Polyclonal Antibody (orb587613). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings