OR9G1 Peptide - C-terminal region

Produktübersicht

• Artikelname: OR9G1 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004177
• Hersteller Artikelnummer: orb2004177
• Alternativnummer: BYT-ORB2004177-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: OR9G5

Produktbeschreibung

OR9G1 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 001005213
• UniProt: Q8NH87
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: ILYIYALPRSSYSFDMDKIVSTFYTVVFPMLNLMIYSLRNKDVKEALKKL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with OR9G1 Rabbit Polyclonal Antibody (orb587608). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings