SCFD1 Peptide - C-terminal region

Artikelnummer: BYT-ORB2004180
Artikelname: SCFD1 Peptide - C-terminal region
Artikelnummer: BYT-ORB2004180
Hersteller Artikelnummer: orb2004180
Alternativnummer: BYT-ORB2004180-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
SCFD1 Peptide - C-terminal region
UniProt: Q8WVM8
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: YFDPKMLRGNDSSVPRNKNPFQEAIVFVVGGGNYIEYQNLVDYIKGKQGK
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with SCFD1 Rabbit Polyclonal Antibody (orb582919). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings