SFMBT1 Peptide - middle region

Artikelnummer: BYT-ORB2004183
Artikelname: SFMBT1 Peptide - middle region
Artikelnummer: BYT-ORB2004183
Hersteller Artikelnummer: orb2004183
Alternativnummer: BYT-ORB2004183-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
SFMBT1 Peptide - middle region
UniProt: Q9UHJ3
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: PGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVLKAKYKG
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with SFMBT1 Rabbit Polyclonal Antibody (orb330611). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings