GTDC1 Peptide - N-terminal region

Produktübersicht

• Artikelname: GTDC1 Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004188
• Hersteller Artikelnummer: orb2004188
• Alternativnummer: BYT-ORB2004188-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB

Produktbeschreibung

GTDC1 Peptide - N-terminal region

Produkteigenschaften

• UniProt: B8ZZ45
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: LIIEAFYGGSHKQLVDLLQEELGDCVVYTLPAKKWHWRARTSALYFSQTI

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with GTDC1 Rabbit Polyclonal Antibody (orb580573). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings