FOXK1 Peptide - C-terminal region

Produktübersicht

• Artikelname: FOXK1 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004189
• Hersteller Artikelnummer: orb2004189
• Alternativnummer: BYT-ORB2004189-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB

Produktbeschreibung

FOXK1 Peptide - C-terminal region

Produkteigenschaften

• UniProt: P85037
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: PHDPEFGSKLASVPEYRYSQSAPGSPVSAQPVIMAVPPRPSSLVAKPVAY

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with FOXK1 Rabbit Polyclonal Antibody (orb580092). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings