SLC6A6 Peptide - C-terminal region

Produktübersicht

• Artikelname: SLC6A6 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004193
• Hersteller Artikelnummer: orb2004193
• Alternativnummer: BYT-ORB2004193-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB

Produktbeschreibung

SLC6A6 Peptide - C-terminal region

Produkteigenschaften

• UniProt: E9PDM3
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: EFWERNVLSLSPGIDHPGSLKWDLALCLLLVWLVCFFCIWKGVRSTGKVV

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with SLC6A6 Rabbit Polyclonal Antibody (orb578952). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings