PRDM11 Peptide - C-terminal region

Artikelnummer: BYT-ORB2004208
Artikelname: PRDM11 Peptide - C-terminal region
Artikelnummer: BYT-ORB2004208
Hersteller Artikelnummer: orb2004208
Alternativnummer: BYT-ORB2004208-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
PRDM11 Peptide - C-terminal region
NCBI: 001243625
UniProt: Q9NQV5
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: IGQTQGEGDWKVPQGVSKEPGQLEDEEEEPSSFKADSPAEASLASDPHEL
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PRDM11 Rabbit Polyclonal Antibody (orb324560). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings