NFKB2 Peptide - N-terminal region

Artikelnummer: BYT-ORB2004215
Artikelname: NFKB2 Peptide - N-terminal region
Artikelnummer: BYT-ORB2004215
Hersteller Artikelnummer: orb2004215
Alternativnummer: BYT-ORB2004215-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
NFKB2 Peptide - N-terminal region
UniProt: Q00653
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: APETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTV
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with NFKB2 Rabbit Polyclonal Antibody (orb573701). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings