TMEM202 Peptide - C-terminal region

Produktübersicht

• Artikelname: TMEM202 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004244
• Hersteller Artikelnummer: orb2004244
• Alternativnummer: BYT-ORB2004244-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB

Produktbeschreibung

TMEM202 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 001073931
• UniProt: A6NGA9
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: LNYLTSRSPACDENVTVIPTERSRLGVGPVTTVSPAKDEGPRSEMESLSV

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with TMEM202 Rabbit Polyclonal Antibody (orb327129). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings