INO80C Peptide - N-terminal region

Produktübersicht

• Artikelname: INO80C Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004250
• Hersteller Artikelnummer: orb2004250
• Alternativnummer: BYT-ORB2004250-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB

Produktbeschreibung

INO80C Peptide - N-terminal region

Produkteigenschaften

• UniProt: Q6PI98
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: VATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISME

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with INO80C Rabbit Polyclonal Antibody (orb587463). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings