PPP2CA Peptide - N-terminal region

Artikelnummer: BYT-ORB2004256
Artikelname: PPP2CA Peptide - N-terminal region
Artikelnummer: BYT-ORB2004256
Hersteller Artikelnummer: orb2004256
Alternativnummer: BYT-ORB2004256-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
PPP2CA Peptide - N-terminal region
UniProt: P67775
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: FHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERI
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PPP2CA Rabbit Polyclonal Antibody (orb583049). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings