OBP2A Peptide - middle region

Artikelnummer: BYT-ORB2004264
Artikelname: OBP2A Peptide - middle region
Artikelnummer: BYT-ORB2004264
Hersteller Artikelnummer: orb2004264
Alternativnummer: BYT-ORB2004264-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
OBP2A Peptide - middle region
UniProt: Q9NY56
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: QKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYM
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with OBP2A Rabbit Polyclonal Antibody (orb582626). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings