SESN1 Peptide - middle region

Produktübersicht

• Artikelname: SESN1 Peptide - middle region
• Artikelnummer: BYT-ORB2004265
• Hersteller Artikelnummer: orb2004265
• Alternativnummer: BYT-ORB2004265-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: PA26, SEST1

Produktbeschreibung

SESN1 Peptide - middle region

Produkteigenschaften

• NCBI: 055269
• UniProt: Q9Y6P5
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: KWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with SESN1 Rabbit Polyclonal Antibody (orb582610). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings