ARID5B Peptide - N-terminal region

Produktübersicht

• Artikelname: ARID5B Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004278
• Hersteller Artikelnummer: orb2004278
• Alternativnummer: BYT-ORB2004278-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: DESRT, MRF-2, MRF2

Produktbeschreibung

ARID5B Peptide - N-terminal region

Produkteigenschaften

• NCBI: 115575
• UniProt: Q14865
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: FLPEDTPQGRNSDHGEDEVIAVSEKVIVKLEDLVKWVHSDFSKWRCGFHA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with ARID5B Rabbit Polyclonal Antibody (orb581184). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings