MED25 Peptide - C-terminal region

Produktübersicht

• Artikelname: MED25 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004279
• Hersteller Artikelnummer: orb2004279
• Alternativnummer: BYT-ORB2004279-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: ChIP, WB

Produktbeschreibung

MED25 Peptide - C-terminal region

Produkteigenschaften

• UniProt: B9TX37
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: PPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDI

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with MED25 Rabbit Polyclonal Antibody (orb581182). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings