ZNF134 Peptide - middle region

Artikelnummer: BYT-ORB2004280
Artikelname: ZNF134 Peptide - middle region
Artikelnummer: BYT-ORB2004280
Hersteller Artikelnummer: orb2004280
Alternativnummer: BYT-ORB2004280-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
ZNF134 Peptide - middle region
UniProt: P52741
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: TLVQHQRIHSGEKPYECSECGKAFSRKATLVQHQRIHTGERPYECSECGK
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with ZNF134 Rabbit Polyclonal Antibody (orb581058). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings