PCDHB14 Peptide - middle region

Produktübersicht

• Artikelname: PCDHB14 Peptide - middle region
• Artikelnummer: BYT-ORB2004283
• Hersteller Artikelnummer: orb2004283
• Alternativnummer: BYT-ORB2004283-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB

Produktbeschreibung

PCDHB14 Peptide - middle region

Produkteigenschaften

• UniProt: B4DPE2
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: YGKISYTFFHASEDIRKTFEINPISGEVNLRSPLDFEVIQSYTINIQATD

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PCDHB14 Rabbit Polyclonal Antibody (orb580716). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings