GALNT9 Peptide - C-terminal region

Produktübersicht

• Artikelname: GALNT9 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004285
• Hersteller Artikelnummer: orb2004285
• Alternativnummer: BYT-ORB2004285-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: GALNAC-T9

Produktbeschreibung

GALNT9 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 001116108
• UniProt: J3KNN1
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: DFGDVSERLALRQRLKCRSFKWYLENVYPEMRVYNNTLTYGEVRNSKASA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with GALNT9 Rabbit Polyclonal Antibody (orb580556). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings