MTAP Peptide - N-terminal region

Produktübersicht

• Artikelname: MTAP Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004286
• Hersteller Artikelnummer: orb2004286
• Alternativnummer: BYT-ORB2004286-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB

Produktbeschreibung

MTAP Peptide - N-terminal region

Produkteigenschaften

• UniProt: Q13126
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: ASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIK

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with MTAP Rabbit Polyclonal Antibody (orb580454). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings