RHBDL2 Peptide - N-terminal region

Artikelnummer: BYT-ORB2004287
Artikelname: RHBDL2 Peptide - N-terminal region
Artikelnummer: BYT-ORB2004287
Hersteller Artikelnummer: orb2004287
Alternativnummer: BYT-ORB2004287-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: RRP2
RHBDL2 Peptide - N-terminal region
NCBI: 060291
UniProt: B3KUN4
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: ELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPPP
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with RHBDL2 Rabbit Polyclonal Antibody (orb325335). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings