RRM2B Peptide - middle region

Artikelnummer: BYT-ORB2004290
Artikelname: RRM2B Peptide - middle region
Artikelnummer: BYT-ORB2004290
Hersteller Artikelnummer: orb2004290
Alternativnummer: BYT-ORB2004290-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
RRM2B Peptide - middle region
UniProt: Q7LG56
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: VHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKST
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with RRM2B Rabbit Polyclonal Antibody (orb579630). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings