NAT2 Peptide - C-terminal region

Produktübersicht

• Artikelname: NAT2 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004301
• Hersteller Artikelnummer: orb2004301
• Alternativnummer: BYT-ORB2004301-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB

Produktbeschreibung

NAT2 Peptide - C-terminal region

Produkteigenschaften

• UniProt: A4Z7J7
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: TPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with NAT2 Rabbit Polyclonal Antibody (orb330371). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings