BARD1 Peptide - C-terminal region

Artikelnummer: BYT-ORB2004311
Artikelname: BARD1 Peptide - C-terminal region
Artikelnummer: BYT-ORB2004311
Hersteller Artikelnummer: orb2004311
Alternativnummer: BYT-ORB2004311-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
BARD1 Peptide - C-terminal region
UniProt: F6MDH8
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: LFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTV
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with BARD1 Rabbit Polyclonal Antibody (orb578662). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings