RADIL Peptide - C-terminal region

Artikelnummer: BYT-ORB2004312
Artikelname: RADIL Peptide - C-terminal region
Artikelnummer: BYT-ORB2004312
Hersteller Artikelnummer: orb2004312
Alternativnummer: BYT-ORB2004312-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
RADIL Peptide - C-terminal region
UniProt: Q96JH8
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: ADGRLSLGDRILEVNGSSLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETA
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with RADIL Rabbit Polyclonal Antibody (orb578650). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings