PITX1 Peptide - middle region

Artikelnummer: BYT-ORB2009519
Artikelname: PITX1 Peptide - middle region
Artikelnummer: BYT-ORB2009519
Hersteller Artikelnummer: orb2009519
Alternativnummer: BYT-ORB2009519-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: BFT, CCF, POTX, PTX1
PITX1 Peptide - middle region
Molekulargewicht: 34kDa
NCBI: 002644
UniProt: P78337
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: YVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLS
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PITX1 Rabbit Polyclonal Antibody (orb574149). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings