OVGP1 Peptide - C-terminal region

Artikelnummer: BYT-ORB2009636
Artikelname: OVGP1 Peptide - C-terminal region
Artikelnummer: BYT-ORB2009636
Hersteller Artikelnummer: orb2009636
Alternativnummer: BYT-ORB2009636-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: CHIT5, EGP, MUC9, OGP
OVGP1 Peptide - C-terminal region
Molekulargewicht: 75kDa
NCBI: 002548
UniProt: Q12889
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: QLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEEA
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with OVGP1 Rabbit Polyclonal Antibody (orb584611). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings