OSGIN2 Peptide - C-terminal region

Artikelnummer: BYT-ORB2009646
Artikelname: OSGIN2 Peptide - C-terminal region
Artikelnummer: BYT-ORB2009646
Hersteller Artikelnummer: orb2009646
Alternativnummer: BYT-ORB2009646-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: C8orf1, hT41
OSGIN2 Peptide - C-terminal region
Molekulargewicht: 42kDa
NCBI: 004328
UniProt: Q9Y236
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: HANYYYNNTDGLYFIYLIALCLGSLNSCLDPFLYFLMSKTRNHSTAYLTK
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with OSGIN2 Rabbit Polyclonal Antibody (orb584563). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings