OSCAR Peptide - C-terminal region

Artikelnummer: BYT-ORB2009648
Artikelname: OSCAR Peptide - C-terminal region
Artikelnummer: BYT-ORB2009648
Hersteller Artikelnummer: orb2009648
Alternativnummer: BYT-ORB2009648-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: MGC33613, PIGR3
OSCAR Peptide - C-terminal region
Molekulargewicht: 27kDa
NCBI: 573398
UniProt: Q8IYS5
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: LSQRSEVLVISWEDSGSSDYTRGNLVRLGLAGLVLISLGALVTFDWRSQN
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with OSCAR Rabbit Polyclonal Antibody (orb331211). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings