TNFRSF10C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2081449
Artikelname: TNFRSF10C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2081449
Hersteller Artikelnummer: orb2081449
Alternativnummer: BYT-ORB2081449-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TNFRSF10C
Konjugation: Biotin
Alternative Synonym: LIT, DCR1, TRID, CD263, TRAILR3, TRAIL-R3, DCR1-TNFR
TNFRSF10C Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 003832
UniProt: O14798
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKG