NME1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2081566
Artikelname: NME1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2081566
Hersteller Artikelnummer: orb2081566
Alternativnummer: BYT-ORB2081566-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: DOT, IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NME1
Konjugation: Biotin
Alternative Synonym: NB, AWD, NBS, GAAD, NDKA, NM23, NDPKA, NDPK-A, NM23-H1
NME1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 000260
UniProt: P22392
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEH