KRT15 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2081570
Artikelname: KRT15 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2081570
Hersteller Artikelnummer: orb2081570
Alternativnummer: BYT-ORB2081570-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KRT15
Konjugation: HRP
Alternative Synonym: K15, CK15, K1CO
KRT15 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 002266
UniProt: P19012
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI