CDK4 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2081576
Artikelname: CDK4 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2081576
Hersteller Artikelnummer: orb2081576
Alternativnummer: BYT-ORB2081576-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CDK4
Konjugation: HRP
Alternative Synonym: CMM3, PSK-J3
CDK4 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 000066
UniProt: P11802
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE